ZNF629 polyclonal antibody
  • ZNF629 polyclonal antibody

ZNF629 polyclonal antibody

Ref: AB-PAB21218
ZNF629 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZNF629.
Información adicional
Size 100 uL
Gene Name ZNF629
Gene Alias KIAA0326|ZNF|ZNF65
Gene Description zinc finger protein 629
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq NADGLIAHAAPKPPQLRSPRLPFRGNSYPGAAEGRAEAPGQPLKPPEGQEGFSQRRGLLSSKT
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF629.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23361
Iso type IgG

Enviar uma mensagem


ZNF629 polyclonal antibody

ZNF629 polyclonal antibody