PRCC polyclonal antibody
  • PRCC polyclonal antibody

PRCC polyclonal antibody

Ref: AB-PAB21212
PRCC polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PRCC.
Información adicional
Size 100 uL
Gene Name PRCC
Gene Alias MGC17178|MGC4723|RCCP1|TPRC
Gene Description papillary renal cell carcinoma (translocation-associated)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq PDEAEPEPEEEEAVAPTSGPALGGLFASLPAPKGPALLPPPPQMLAPAFPPPLLLPPPTGDPRLQPPPPLPFGLGGFPPPPGVSPAEAAGVGEGLGLGLPS
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PRCC.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 5546
Iso type IgG

Enviar uma mensagem


PRCC polyclonal antibody

PRCC polyclonal antibody