FLJ22374 polyclonal antibody
  • FLJ22374 polyclonal antibody

FLJ22374 polyclonal antibody

Ref: AB-PAB21210
FLJ22374 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FLJ22374.
Información adicional
Size 100 uL
Gene Name FLJ22374
Gene Alias MGC44277
Gene Description hypothetical protein FLJ22374
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq TTLVNIYDLSDEDAGWRTSLSETSKARHDNLDGDVLGNFVSSKRPPHKSKPMQTVPGETPVLTSAWEKIDKLHSEPSLDVKRMGENSRPKSGLIV
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FLJ22374.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 84182
Iso type IgG

Enviar uma mensagem


FLJ22374 polyclonal antibody

FLJ22374 polyclonal antibody