SAMD9L polyclonal antibody
  • SAMD9L polyclonal antibody

SAMD9L polyclonal antibody

Ref: AB-PAB21206
SAMD9L polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SAMD9L.
Información adicional
Size 100 uL
Gene Name SAMD9L
Gene Alias C7orf6|DRIF2|FLJ39885|KIAA2005|UEF1
Gene Description sterile alpha motif domain containing 9-like
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq ECYLALSKFTSHLKNLQSDLKRCFDFFIDYMVLLKMRYTQKEIAEIMLSKKVSRCFRKYTELFCHLDPCLLQSKESQLLQEENCRKKLEALRADRFAGLLEYLNPNYKDAT
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SAMD9L.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 219285
Iso type IgG

Enviar uma mensagem


SAMD9L polyclonal antibody

SAMD9L polyclonal antibody