LRBA polyclonal antibody
  • LRBA polyclonal antibody

LRBA polyclonal antibody

Ref: AB-PAB21205
LRBA polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LRBA.
Información adicional
Size 100 uL
Gene Name LRBA
Gene Alias BGL|CDC4L|DKFZp686A09128|DKFZp686K03100|DKFZp686P2258|FLJ16600|FLJ25686|LAB300|LBA|MGC72098
Gene Description LPS-responsive vesicle trafficking, beach and anchor containing
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SVLMVSKYRDILEPQNERHSQSCTETGSENENVSLSEITPAAFSTLTTASVEESESTSSARRRDSGIGEETATGLGSHVEVTPHTAPPGVSAGPDAISEVLSTLSLEVNKSPETKNDRGNDLDTKATPSVSV
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LRBA.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 987
Iso type IgG

Enviar uma mensagem


LRBA polyclonal antibody

LRBA polyclonal antibody