FAM161B polyclonal antibody
  • FAM161B polyclonal antibody

FAM161B polyclonal antibody

Ref: AB-PAB21190
FAM161B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAM161B.
Información adicional
Size 100 uL
Gene Name FAM161B
Gene Alias C14orf44|FLJ31697|c14_5547
Gene Description family with sequence similarity 161, member B
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq GSRQIFPPESFADTEAGEELSGDGLVLPRASKLDEFLSPEEEIDSTSDSTGSIYQNLQELKQKGRWCLLESLFQSDPESDENLSEDEEDLESFFQDKDRGMVQVQCPQALRCGSTRRCSSLNNLPSNIPRPQTQPPS
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAM161B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 145483
Iso type IgG

Enviar uma mensagem


FAM161B polyclonal antibody

FAM161B polyclonal antibody