RBM28 polyclonal antibody
  • RBM28 polyclonal antibody

RBM28 polyclonal antibody

Ref: AB-PAB21187
RBM28 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RBM28.
Información adicional
Size 100 uL
Gene Name RBM28
Gene Alias FLJ10377
Gene Description RNA binding motif protein 28
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq RKLLLSATSGEKGVRIKECRVMRDLKGVHGNMKGQSLGYAFAEFQEHEHALKALRLINNNPEIFGPLKRPIVEFSLEDRRKLKMKELRIQRSLQKMRSKPATGEPQKGQPEPAKDQQQK
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RBM28.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55131
Iso type IgG

Enviar uma mensagem


RBM28 polyclonal antibody

RBM28 polyclonal antibody