CHN2 polyclonal antibody
  • CHN2 polyclonal antibody

CHN2 polyclonal antibody

Ref: AB-PAB21183
CHN2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CHN2.
Información adicional
Size 100 uL
Gene Name CHN2
Gene Alias ARHGAP3|BCH|MGC138360|RHOGAP3
Gene Description chimerin (chimaerin) 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq ASSNSSLSGSSVSSDAEEYQPPIWKSYLYQLQQEAPRPKRIICPREVENRPKY
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CHN2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 1124
Iso type IgG

Enviar uma mensagem


CHN2 polyclonal antibody

CHN2 polyclonal antibody