NLE1 polyclonal antibody
  • NLE1 polyclonal antibody

NLE1 polyclonal antibody

Ref: AB-PAB21176
NLE1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant NLE1.
Información adicional
Size 100 uL
Gene Name NLE1
Gene Alias FLJ10458|Nle
Gene Description notchless homolog 1 (Drosophila)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq TIKVWRAHDGVLCRTLQGHGHWVNTMALSTDYALRTGAFEPAEASVNPQDLQGSLQELKERALSRYNLVRGQGPERLVSGSDDFTL
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human NLE1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 54475
Iso type IgG

Enviar uma mensagem


NLE1 polyclonal antibody

NLE1 polyclonal antibody