ANGPT1 polyclonal antibody
  • ANGPT1 polyclonal antibody

ANGPT1 polyclonal antibody

Ref: AB-PAB21173
ANGPT1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ANGPT1.
Información adicional
Size 100 uL
Gene Name ANGPT1
Gene Alias AGP1|AGPT|ANG1
Gene Description angiopoietin 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq EKENLQGLVTRQTYIIQELEKQLNRATTNNSVLQKQQLELMDTVHNLVNLCTKEGVLLKGGKREEEKPFR
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ANGPT1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 284
Iso type IgG

Enviar uma mensagem


ANGPT1 polyclonal antibody

ANGPT1 polyclonal antibody