RASGRF2 polyclonal antibody
  • RASGRF2 polyclonal antibody

RASGRF2 polyclonal antibody

Ref: AB-PAB21172
RASGRF2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RASGRF2.
Información adicional
Size 100 uL
Gene Name RASGRF2
Gene Alias DKFZp781H1715|GRF2|RAS-GRF2
Gene Description Ras protein-specific guanine nucleotide-releasing factor 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq FATSQNNRGEHLVDGKSPRLCRKFSSPPPLAVSRTSSPVRARKLSLTSPLNSKIGALDLTTSSSPTTTTQSPAASPPPHTGQIPLDLSRGLSSPEQSPGTVEENVD
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RASGRF2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 5924
Iso type IgG

Enviar uma mensagem


RASGRF2 polyclonal antibody

RASGRF2 polyclonal antibody