ERGIC1 polyclonal antibody
  • ERGIC1 polyclonal antibody

ERGIC1 polyclonal antibody

Ref: AB-PAB21171
ERGIC1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ERGIC1.
Información adicional
Size 100 uL
Gene Name ERGIC1
Gene Alias ERGIC-32|ERGIC32|FLJ39864|KIAA1181|MGC14345
Gene Description endoplasmic reticulum-golgi intermediate compartment (ERGIC) 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq VVNELYVDDPDKDSGGKIDVSLNISLPNLHCELVGLDIQDEMGRHEVGHIDNSMKIPLNNGAGCRFEGQFSINK
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ERGIC1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 57222
Iso type IgG

Enviar uma mensagem


ERGIC1 polyclonal antibody

ERGIC1 polyclonal antibody