SLC38A6 polyclonal antibody
  • SLC38A6 polyclonal antibody

SLC38A6 polyclonal antibody

Ref: AB-PAB21170
SLC38A6 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SLC38A6.
Información adicional
Size 100 uL
Gene Name SLC38A6
Gene Alias MGC102697|NAT-1
Gene Description solute carrier family 38, member 6
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq KWSIPCPLTLNYVEKGFQISNVTDDCKPKLFHFSKESA
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SLC38A6.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 145389
Iso type IgG

Enviar uma mensagem


SLC38A6 polyclonal antibody

SLC38A6 polyclonal antibody