G3BP2 polyclonal antibody
  • G3BP2 polyclonal antibody

G3BP2 polyclonal antibody

Ref: AB-PAB21165
G3BP2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant G3BP2.
Información adicional
Size 100 uL
Gene Name G3BP2
Gene Alias -
Gene Description GTPase activating protein (SH3 domain) binding protein 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq KNLEELEEKSTTPPPAEPVSLPQEPPKPRVEAKPEVQSQPPRVREQRPRERPGFPPRGPRPGRGDMEQNDS
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human G3BP2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9908
Iso type IgG

Enviar uma mensagem


G3BP2 polyclonal antibody

G3BP2 polyclonal antibody