POLDIP3 polyclonal antibody
  • POLDIP3 polyclonal antibody

POLDIP3 polyclonal antibody

Ref: AB-PAB21164
POLDIP3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant POLDIP3.
Información adicional
Size 100 uL
Gene Name POLDIP3
Gene Alias KIAA1649|PDIP46|SKAR
Gene Description polymerase (DNA-directed), delta interacting protein 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq SLDELIRKRGAAAKGRLNARPGVGGVRSRVGIQQGLLSQSTRTATFQQRFDARQKIGLSDARLKLGVKDAREKLLQKDARFRIKGKVQDAR
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human POLDIP3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 84271
Iso type IgG

Enviar uma mensagem


POLDIP3 polyclonal antibody

POLDIP3 polyclonal antibody