C14orf177 polyclonal antibody
  • C14orf177 polyclonal antibody

C14orf177 polyclonal antibody

Ref: AB-PAB21155
C14orf177 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C14orf177.
Información adicional
Size 100 uL
Gene Name C14orf177
Gene Alias FLJ25773
Gene Description chromosome 14 open reading frame 177
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq HRKEPGARLEATRGAARPHKQGTKPMITRPSVSQLGEGKCPSSQHLQSLRHNKQHALTLTKARCCGECSTCFCTEEKSECQRHEETSPGSCNHQIMSASTISAFCATPRFKQLFKGTVEQMSQM
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C14orf177.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 283598
Iso type IgG

Enviar uma mensagem


C14orf177 polyclonal antibody

C14orf177 polyclonal antibody