MFAP3L polyclonal antibody
  • MFAP3L polyclonal antibody

MFAP3L polyclonal antibody

Ref: AB-PAB21153
MFAP3L polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MFAP3L.
Información adicional
Size 100 uL
Gene Name MFAP3L
Gene Alias NYD-sp9
Gene Description microfibrillar-associated protein 3-like
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq TNSTLNGTNVVLGSVPVIIARTDHIIVKEGNSALINCSVYGIPDPQFKWYNSIGKLLKEEEDEKERGGGKWQMHDSGLLNITKVSFSDRGKYTCVASNIYGTVNNTVTLRVIFTSGD
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MFAP3L.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9848
Iso type IgG

Enviar uma mensagem


MFAP3L polyclonal antibody

MFAP3L polyclonal antibody