TOX4 polyclonal antibody
  • TOX4 polyclonal antibody

TOX4 polyclonal antibody

Ref: AB-PAB21150
TOX4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TOX4.
Información adicional
Size 100 uL
Gene Name TOX4
Gene Alias C14orf92|KIAA0737|LCP1|MIG7
Gene Description TOX high mobility group box family member 4
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB,IHC-P,IF
Immunogen Prot. Seq MQQPPPQKVRINLQQQPPPLQIKSVPLPTLKMQTTLVPPTVESSPERPMNNSPEAHTVEAPSPETICEMITDVVPEVESPSQMDVELVSGSPVALSPQPRCVRSGCENPPIVSKDWDNEYCSNECVVKHCRDVFLAWVAS
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TOX4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9878
Iso type IgG

Enviar uma mensagem


TOX4 polyclonal antibody

TOX4 polyclonal antibody