ITIH3 polyclonal antibody
  • ITIH3 polyclonal antibody

ITIH3 polyclonal antibody

Ref: AB-PAB21146
ITIH3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ITIH3.
Información adicional
Size 100 uL
Gene Name ITIH3
Gene Alias H3P
Gene Description inter-alpha (globulin) inhibitor H3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq NDLTFTEEVDMKEMEKALQERDYIFGNYIERLWAYLTIEQLLEKRKNAHGEEKENLTARALDLSLKYHFVTPLTSMVVTKPEDNEDERAIADKPGEDAEATPVSPAMSYLTSYQPPQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ITIH3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 3699
Iso type IgG

Enviar uma mensagem


ITIH3 polyclonal antibody

ITIH3 polyclonal antibody