GHITM polyclonal antibody
  • GHITM polyclonal antibody

GHITM polyclonal antibody

Ref: AB-PAB21137
GHITM polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant GHITM.
Información adicional
Size 100 uL
Gene Name GHITM
Gene Alias DERP2|DKFZp566C0746|FLJ26584|HSPC282|MICS1|My021|PTD010|TMBIM5
Gene Description growth hormone inducible transmembrane protein
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq DTQKVIKRAEVSPMYGVQKYDPINSMLSIYMDTLNIFMRVATMLATGGNRKK
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human GHITM.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 27069
Iso type IgG

Enviar uma mensagem


GHITM polyclonal antibody

GHITM polyclonal antibody