UBAC2 polyclonal antibody
  • UBAC2 polyclonal antibody

UBAC2 polyclonal antibody

Ref: AB-PAB21123
UBAC2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant UBAC2.
Información adicional
Size 100 uL
Gene Name UBAC2
Gene Alias FLJ26351|FLJ30001|FLJ30548|FLJ42413|MGC90487|PHGDHL1
Gene Description UBA domain containing 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq YDSKMFQVHQVLCIPSWMAKFFSWTLEPIFSSSEPTSEARIGMGATLDIQRQQRMELLDRQLMFSQFAQGRRQRQQQGGMINWNRLFPPLRQRQNVNYQGGRQSEPAAPPLEVSEEQVARLMEMGFSRGDALEALRASNNDLN
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human UBAC2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 337867
Iso type IgG

Enviar uma mensagem


UBAC2 polyclonal antibody

UBAC2 polyclonal antibody