TOR1B polyclonal antibody
  • TOR1B polyclonal antibody

TOR1B polyclonal antibody

Ref: AB-PAB21122
TOR1B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TOR1B.
Información adicional
Size 100 uL
Gene Name TOR1B
Gene Alias DQ1|MGC4386
Gene Description torsin family 1, member B (torsin B)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB,IHC-P
Immunogen Prot. Seq LITKTALDFWRAGRKREDIQLKDLEPVLSVGVFNNKHSGLWHSGLIDKNLIDYFIPFLPLEYRHVKMCVRAEMRARGSAIDEDIVTRVAEEMTFFPRDEKIYSDKGCKTVQSRLDFH
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TOR1B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 27348
Iso type IgG

Enviar uma mensagem


TOR1B polyclonal antibody

TOR1B polyclonal antibody