MYEOV polyclonal antibody
  • MYEOV polyclonal antibody

MYEOV polyclonal antibody

Ref: AB-PAB21120
MYEOV polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MYEOV.
Información adicional
Size 100 uL
Gene Name MYEOV
Gene Alias OCIM
Gene Description myeloma overexpressed (in a subset of t(11
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq TPALPIGLCTRCCLCLEQSPSWCHCLRGVSFLTFHLHQSVPLGDRDSLLMFTRQAGHFVEGSKAGRSRGRLCLSQALRVAVRGAFVSLWFAAGAGDRERNKGDKGAQTGAGLSQEAEDVDVSRARRVTDAPQGTLCGTGN
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MYEOV.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 26579
Iso type IgG

Enviar uma mensagem


MYEOV polyclonal antibody

MYEOV polyclonal antibody