FHDC1 polyclonal antibody
  • FHDC1 polyclonal antibody

FHDC1 polyclonal antibody

Ref: AB-PAB21112
FHDC1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FHDC1.
Información adicional
Size 100 uL
Gene Name FHDC1
Gene Alias KIAA1727
Gene Description FH2 domain containing 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq EHELVTGLAQFNLQGSQGMEETSQLTLSDFSPMELESVGHRGPQSLSASSSSLTPMGRDALGSLSPALEDGKAAPDEPGSAALGSVGSSDPENKDPRPLFCISDTTDCSLTLDCSEGTDSRPRGGDPEEGGEGDGSMSSGV
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FHDC1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 85462
Iso type IgG

Enviar uma mensagem


FHDC1 polyclonal antibody

FHDC1 polyclonal antibody