LTA4H polyclonal antibody
  • LTA4H polyclonal antibody

LTA4H polyclonal antibody

Ref: AB-PAB21110
LTA4H polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LTA4H.
Información adicional
Size 100 uL
Gene Name LTA4H
Gene Alias -
Gene Description leukotriene A4 hydrolase
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq ALTVQSQEDNLRSLVLDTKDLTIEKVVINGQEVKYALGERQSYKGSPMEISLPIALSKNQEIVIEISFETSPKSSALQWLTPEQTSGKEHPYLFSQCQAIHCRAILPCQDTPSVKLTYTAEVSVPKELVALMSAIRDGET
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LTA4H.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 4048
Iso type IgG

Enviar uma mensagem


LTA4H polyclonal antibody

LTA4H polyclonal antibody