NKAIN1 polyclonal antibody
  • NKAIN1 polyclonal antibody

NKAIN1 polyclonal antibody

Ref: AB-PAB21108
NKAIN1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant NKAIN1.
Información adicional
Size 100 uL
Gene Name NKAIN1
Gene Alias FAM77C|FLJ12650
Gene Description Na+/K+ transporting ATPase interacting 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq DRDFIMTFNTSLHRSWWMENGPGCLVTPVLNSRLALEDHHVISVTGCLLDYPY
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human NKAIN1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 79570
Iso type IgG

Enviar uma mensagem


NKAIN1 polyclonal antibody

NKAIN1 polyclonal antibody