CMC2 polyclonal antibody
  • CMC2 polyclonal antibody

CMC2 polyclonal antibody

Ref: AB-PAB21107
CMC2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CMC2.
Información adicional
Size 100 uL
Gene Name CMC2
Gene Alias DC13|2310061C15Rik|C16orf61
Gene Description COX assembly mitochondrial protein 2 homolog (S. cerevisiae)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq MHPDLSPHLHTEECNVLINLLKECHKNHNILKFFGYCNDVDRELRKCLKNEYVENRTKSREHGIAMRKKL
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CMC2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 56942
Iso type IgG

Enviar uma mensagem


CMC2 polyclonal antibody

CMC2 polyclonal antibody