SCUBE2 polyclonal antibody
  • SCUBE2 polyclonal antibody

SCUBE2 polyclonal antibody

Ref: AB-PAB21106
SCUBE2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SCUBE2.
Información adicional
Size 100 uL
Gene Name SCUBE2
Gene Alias CEGP1|Cegb1|Cegf1|FLJ16792|FLJ35234|MGC133057
Gene Description signal peptide, CUB domain, EGF-like 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq ESCGVGQGHAENQCVSCRAGTYYDGARERCILCPNGTFQNEEGQMTCEPCPRPGNSGALKTPEAWNMSECGGLCQPGEYSADGFAPCQLCALGTFQPEAGRTSC
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SCUBE2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 57758
Iso type IgG

Enviar uma mensagem


SCUBE2 polyclonal antibody

SCUBE2 polyclonal antibody