SLC16A7 polyclonal antibody
  • SLC16A7 polyclonal antibody

SLC16A7 polyclonal antibody

Ref: AB-PAB21105
SLC16A7 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SLC16A7.
Información adicional
Size 100 uL
Gene Name SLC16A7
Gene Alias MCT2
Gene Description solute carrier family 16, member 7 (monocarboxylic acid transporter 2)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq GPNQTTSKSKNKTGKTEDDSSPKKIKTKKSTWEKVNKYLDFS
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SLC16A7.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9194
Iso type IgG

Enviar uma mensagem


SLC16A7 polyclonal antibody

SLC16A7 polyclonal antibody