C6orf211 polyclonal antibody
  • C6orf211 polyclonal antibody

C6orf211 polyclonal antibody

Ref: AB-PAB21103
C6orf211 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C6orf211.
Información adicional
Size 100 uL
Gene Name C6orf211
Gene Alias DKFZp566I174|FLJ12910
Gene Description chromosome 6 open reading frame 211
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq LVTDLILADFLLSSELATEVHFYGKTIPWFVSDTTIHDFNWLIEQVKHSNHKWMSKCGADWEEYIKMGKWVYHNHIFWTLPHEYCAMPQVAPDLYAELQKAHLILFKGDLNYRKLTGDRK
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C6orf211.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 79624
Iso type IgG

Enviar uma mensagem


C6orf211 polyclonal antibody

C6orf211 polyclonal antibody