KIAA1217 polyclonal antibody
  • KIAA1217 polyclonal antibody

KIAA1217 polyclonal antibody

Ref: AB-PAB21097
KIAA1217 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant KIAA1217.
Información adicional
Size 100 uL
Gene Name KIAA1217
Gene Alias DKFZp761L0424|MGC31990|SKT
Gene Description KIAA1217
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq KEEPHKLDSLLKRVRSMTDVLTMLRRHVTDGLLKGTDAAQAAQYMAMEKATAAEVLKSQEEAAHTSGQPFHSTGAPGDAKSEVVPLSGMMVRHAQSSPVVIQPSQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human KIAA1217.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 56243
Iso type IgG

Enviar uma mensagem


KIAA1217 polyclonal antibody

KIAA1217 polyclonal antibody