TOMM6 polyclonal antibody
  • TOMM6 polyclonal antibody

TOMM6 polyclonal antibody

Ref: AB-PAB21096
TOMM6 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TOMM6.
Información adicional
Size 100 uL
Gene Name TOMM6
Gene Alias DKFZp761H221|FLJ32622|OBTP
Gene Description translocase of outer mitochondrial membrane 6 homolog (yeast)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq MASSTVPVSAAGSANETPEIPDNVGDWLRGVYRFATDRNDFRRNLILNLGLFAAGVWLARNLSDIDLMAPQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TOMM6.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 100188893
Iso type IgG

Enviar uma mensagem


TOMM6 polyclonal antibody

TOMM6 polyclonal antibody