ZDHHC15 polyclonal antibody
  • ZDHHC15 polyclonal antibody

ZDHHC15 polyclonal antibody

Ref: AB-PAB21089
ZDHHC15 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZDHHC15.
Información adicional
Size 100 uL
Gene Name ZDHHC15
Gene Alias FLJ31812|MGC119974|MGC119975|MGC119976|MRX91
Gene Description zinc finger, DHHC-type containing 15
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq VSRNKTTLEAFCTPVFTSGPEKNGFNLGFIKNIQQVFGDKKKFWLIPIGSSPGDGHSFPMRSMNESQNPLLANEETWEDNEDDNQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZDHHC15.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 158866
Iso type IgG

Enviar uma mensagem


ZDHHC15 polyclonal antibody

ZDHHC15 polyclonal antibody