C14orf45 polyclonal antibody
  • C14orf45 polyclonal antibody

C14orf45 polyclonal antibody

Ref: AB-PAB21088
C14orf45 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C14orf45.
Información adicional
Size 100 uL
Gene Name C14orf45
Gene Alias FLJ23189
Gene Description chromosome 14 open reading frame 45
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq PGEAKMPSKGKDKKKGKSKGKDTKKLIKTDESVVDRAKANASLWEARLEVTELSRIKYRDTSRILAKSNEDLKKKQCKMEKDIMSVLSYLKKQDQEKDNM
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C14orf45.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 80127
Iso type IgG

Enviar uma mensagem


C14orf45 polyclonal antibody

C14orf45 polyclonal antibody