CEP97 polyclonal antibody
  • CEP97 polyclonal antibody

CEP97 polyclonal antibody

Ref: AB-PAB21087
CEP97 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CEP97.
Información adicional
Size 100 uL
Gene Name CEP97
Gene Alias 2810403B08Rik|FLJ23047|FLJ26462|LRRIQ2
Gene Description centrosomal protein 97kDa
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq QEEAFRFLWNQVRSLQVWQQTVDQRLSSWHTDVPPISSTLVPSKHPLFTQSQESSCDQNADWFIASDVAPQEKSLPEFPDSGFHSSLTEQVHSLQHSLDFEKSSTEGSESSIMGNSIDTVRYGKESDLGDVSEEHGEWN
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CEP97.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 79598
Iso type IgG

Enviar uma mensagem


CEP97 polyclonal antibody

CEP97 polyclonal antibody