GLDC polyclonal antibody
  • GLDC polyclonal antibody

GLDC polyclonal antibody

Ref: AB-PAB21084
GLDC polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant GLDC.
Información adicional
Size 100 uL
Gene Name GLDC
Gene Alias GCE|GCSP|HYGN1|MGC138198|MGC138200|NKH
Gene Description glycine dehydrogenase (decarboxylating)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq ILNANYMAKRLETHYRILFRGARGYVGHEFILDTRPFKKSANIEAVDVAKRLQDYGFHAPTMSWPVAGTLMVEPTESEDKAELDRFCDAMISIRQEIADIEEGRIDPRVNPLKMSPHSLTCVTSSHWDRPYSREVAAFPLPFVKPENK
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human GLDC.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 2731
Iso type IgG

Enviar uma mensagem


GLDC polyclonal antibody

GLDC polyclonal antibody