ATG2B polyclonal antibody
  • ATG2B polyclonal antibody

ATG2B polyclonal antibody

Ref: AB-PAB21081
ATG2B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ATG2B.
Información adicional
Size 100 uL
Gene Name ATG2B
Gene Alias C14orf103|FLJ10242
Gene Description ATG2 autophagy related 2 homolog B (S. cerevisiae)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq CSKEMPRKAHSNMLTVKALHVCPESGRSPQECCLRVSLMPLRLNIDQDALFFLKDFFTSLSAEVELQMTPDPEVKKSPGADVTCSLPRHLSTSKEPNLVISFSGPKQPSQNDSANSVEVVNGMEEKNFSAEEASFRDQPV
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ATG2B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55102
Iso type IgG

Enviar uma mensagem


ATG2B polyclonal antibody

ATG2B polyclonal antibody