DGCR2 polyclonal antibody
  • DGCR2 polyclonal antibody

DGCR2 polyclonal antibody

Ref: AB-PAB21078
DGCR2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant DGCR2.
Información adicional
Size 100 uL
Gene Name DGCR2
Gene Alias DGS-C|DKFZp686I1730|IDD|KIAA0163|LAN|SEZ-12
Gene Description DiGeorge syndrome critical region gene 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq RFSRKCPTGWHHYEGTASCYRVYLSGENYWDAAQTCQRLNGSLATFSTDQELRFVLAQEWDQPERSFGWKDQRKLWVGYQYVITGRNRSLEGRWEVAFKGSSEVFLPPDPIFASAMSENDNVFCAQLQCFHFPTLRHHDLHSWHAESCYEKSSFLCKRSQTCVDIKDNVVDEGFYFTPK
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human DGCR2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9993
Iso type IgG

Enviar uma mensagem


DGCR2 polyclonal antibody

DGCR2 polyclonal antibody