XPNPEP2 polyclonal antibody
  • XPNPEP2 polyclonal antibody

XPNPEP2 polyclonal antibody

Ref: AB-PAB21077
XPNPEP2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant XPNPEP2.
Información adicional
Size 100 uL
Gene Name XPNPEP2
Gene Alias -
Gene Description X-prolyl aminopeptidase (aminopeptidase P) 2, membrane-bound
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq VRSQMQKHQKVPTAVLLSALEETAWLFNLRASDIPYNPFFYSYTLLTDSSIRLFANKSRFSSETLSYLNSSCTGPMCVQIEDYSQVRDSIQAYSLGDVRIWIGTSYTMYGI
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human XPNPEP2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 7512
Iso type IgG

Enviar uma mensagem


XPNPEP2 polyclonal antibody

XPNPEP2 polyclonal antibody