FAM171A2 polyclonal antibody
  • FAM171A2 polyclonal antibody

FAM171A2 polyclonal antibody

Ref: AB-PAB21076
FAM171A2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAM171A2.
Información adicional
Size 100 uL
Gene Name FAM171A2
Gene Alias MGC34829
Gene Description family with sequence similarity 171, member A2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq RAFPAFLGTEASSSGNGSWLELMPLTAVSVHLLTGNGTEVPLSGPIHLSLPVPSETRALTVGTSIPAWRFDPKSGLWVRNGTGVIRKEGRQLYWTF
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAM171A2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 284069
Iso type IgG

Enviar uma mensagem


FAM171A2 polyclonal antibody

FAM171A2 polyclonal antibody