FAM120A polyclonal antibody
  • FAM120A polyclonal antibody

FAM120A polyclonal antibody

Ref: AB-PAB21074
FAM120A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAM120A.
Información adicional
Size 100 uL
Gene Name FAM120A
Gene Alias C9orf10|DNAPTP1|DNAPTP5|MGC111527|MGC133257
Gene Description family with sequence similarity 120A
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq SGGATNHISGNKIGWEKTGSHSEPQARGDPGDQTKAEGSSTASSGSQLAEGKGSQMGTVQPIPCLLSMPTRNHMDITTPPL
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAM120A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23196
Iso type IgG

Enviar uma mensagem


FAM120A polyclonal antibody

FAM120A polyclonal antibody