C7orf29 polyclonal antibody
  • C7orf29 polyclonal antibody

C7orf29 polyclonal antibody

Ref: AB-PAB21073
C7orf29 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C7orf29.
Información adicional
Size 100 uL
Gene Name C7orf29
Gene Alias -
Gene Description chromosome 7 open reading frame 29
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq GKIEAILPWGPTDIDHWKQVLVYKVKEIRVSEYSLNSPSPLQSPRGLCVDPTRVAKSSGVEGRSQGEPLQSSSHSG
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C7orf29.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 113763
Iso type IgG

Enviar uma mensagem


C7orf29 polyclonal antibody

C7orf29 polyclonal antibody