FAM18B polyclonal antibody
  • FAM18B polyclonal antibody

FAM18B polyclonal antibody

Ref: AB-PAB21072
FAM18B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAM18B.
Información adicional
Size 100 uL
Gene Name FAM18B
Gene Alias CGI-148|FLJ46240|NPD008|YDR084C
Gene Description family with sequence similarity 18, member B
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq RCKVRSRKHLTSMATSYFGKQFLRQNTGDDQTS
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAM18B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 51030
Iso type IgG

Enviar uma mensagem


FAM18B polyclonal antibody

FAM18B polyclonal antibody