SNX30 polyclonal antibody
  • SNX30 polyclonal antibody

SNX30 polyclonal antibody

Ref: AB-PAB21067
SNX30 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SNX30.
Información adicional
Size 100 uL
Gene Name SNX30
Gene Alias FLJ26481|FLJ34280|FLJ35589|FLJ44686|FLJ45069|FLJ46877
Gene Description sorting nexin family member 30
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq VGGDSTPSPDLLMARSFGDKDLILPNGGTPAGTSSPASSSSLLNRLQLDDDIDGETRDLFVIVDDPKKHVCTMETY
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SNX30.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 401548
Iso type IgG

Enviar uma mensagem


SNX30 polyclonal antibody

SNX30 polyclonal antibody