STARD3NL polyclonal antibody
  • STARD3NL polyclonal antibody

STARD3NL polyclonal antibody

Ref: AB-PAB21065
STARD3NL polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant STARD3NL.
Información adicional
Size 100 uL
Gene Name STARD3NL
Gene Alias MENTHO|MGC3251
Gene Description STARD3 N-terminal like
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq MNHLPEDMENALTGSQSSHASLRNIHSINPTQLMARIESYEGREKKGISDVRR
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human STARD3NL.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 83930
Iso type IgG

Enviar uma mensagem


STARD3NL polyclonal antibody

STARD3NL polyclonal antibody