DOLPP1 polyclonal antibody
  • DOLPP1 polyclonal antibody

DOLPP1 polyclonal antibody

Ref: AB-PAB21062
DOLPP1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant DOLPP1.
Información adicional
Size 100 uL
Gene Name DOLPP1
Gene Alias LSFR2
Gene Description dolichyl pyrophosphate phosphatase 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq TQEVLTPLFPRIAAWPVSEFFLIRDTSLIPNVLWFEYTVTRAEARNRQRKLGTKL
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human DOLPP1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 57171
Iso type IgG

Enviar uma mensagem


DOLPP1 polyclonal antibody

DOLPP1 polyclonal antibody