MCOLN2 polyclonal antibody
  • MCOLN2 polyclonal antibody

MCOLN2 polyclonal antibody

Ref: AB-PAB21061
MCOLN2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MCOLN2.
Información adicional
Size 100 uL
Gene Name MCOLN2
Gene Alias FLJ36691|TRP-ML2|TRPML2
Gene Description mucolipin 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq YHQLKDITLGTLGYGENEDNRIGLKVCKQHYKKGTMFPSNETLNIDNDVELDCVQLDLQDLSKKPPDWKNSSFFRLEFYR
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MCOLN2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 255231
Iso type IgG

Enviar uma mensagem


MCOLN2 polyclonal antibody

MCOLN2 polyclonal antibody