PPM2C polyclonal antibody
  • PPM2C polyclonal antibody

PPM2C polyclonal antibody

Ref: AB-PAB21058
PPM2C polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PPM2C.
Información adicional
Size 100 uL
Gene Name PPM2C
Gene Alias FLJ32517|MGC119646|PDH|PDP|PDP1|PDPC
Gene Description protein phosphatase 2C, magnesium-dependent, catalytic subunit
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq YIAVSLLPHETLLEIENAVESGRALLPILQWHKHPNDYFSKEASKLYFNSLRTYWQELIDLNTGESTDIDVKEALINAFKRLDNDISLEAQVGDPNSFLNYLVLRVAFSGATACVAHVD
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PPM2C.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 54704
Iso type IgG

Enviar uma mensagem


PPM2C polyclonal antibody

PPM2C polyclonal antibody