TET1 polyclonal antibody
  • TET1 polyclonal antibody

TET1 polyclonal antibody

Ref: AB-PAB21054
TET1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TET1.
Información adicional
Size 100 uL
Gene Name TET1
Gene Alias CXXC6|FLJ10839|FLJ41442|KIAA1676|LCX|bA119F7.1
Gene Description tet oncogene 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq VPPNPIATFNAPSKWPEPQSTVSYGLAVQGAIQILPLGSGHTPQSSSNSEKNSLPPVMAISNVENEKQVHISFLPANTQGFPLAPERGLFHASLGIAQLSQAGPSKSDRGSSQVSVTSTVHVVNTTVVTMPVPMVSTSSSSYTT
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TET1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 80312
Iso type IgG

Enviar uma mensagem


TET1 polyclonal antibody

TET1 polyclonal antibody