IL17RE polyclonal antibody
  • IL17RE polyclonal antibody

IL17RE polyclonal antibody

Ref: AB-PAB21053
IL17RE polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant IL17RE.
Información adicional
Size 100 uL
Gene Name IL17RE
Gene Alias FLJ23658|MGC71884
Gene Description interleukin 17 receptor E
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq EKSHHISIPSPDISHKGLRSKRTQPSDPETWESLPRLDSQRHGGPEFSFDLLPEARAIRVTISSGPEVSVRLCHQWALECEELSSPYDVQKIVSGGHTVELPYEFLLPCLCMEASYLQEDTVRRKKCPFQSWPEAYGSDFWKSVHFTDYS
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human IL17RE.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 132014
Iso type IgG

Enviar uma mensagem


IL17RE polyclonal antibody

IL17RE polyclonal antibody